DPCstruct | MC19183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 409 ± 78 aa |
| Standard deviation of domain lengths | 77.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.35 |
| Pfam Score | 91.11 |
| Assigned Pfam label(s) | CL0344- CL0105- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4YQX0 | 4-272 | TNGYLMGGPMMGIRLPSEQVGIIKATNCIIAMSDVLFPPAPPALPCIRCTRCAEACPAELQPQELYWFAKAKNFDKARKYNLFDCIE… |
| A0A7H4MXZ0 | 2-320 | VIMGGPLMGFTLPWLDVPVVKITNCLLAPSASEMGEPEEEKGCIRCSACADACPADLLPQQLYWFSKGQQHDKATSHNLADCIECGA… |
| A0A080M5A2 | 36-290 | None |
| A0A0U5GLE4 | 1-511 | None |
| A0A379WAD6 | 116-573 | None |
| A0A498CMN1 | 136-555 | None |
| A0A379GI14 | 136-657 | None |
| A0A2T7B5M4 | 273-770 | None |
| A0A090SDZ1 | 47-454 | None |
| A0A377A0V6 | 2-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.