DPCstruct | MC19182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 638 ± 110 aa |
| Standard deviation of domain lengths | 110.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 80.48 |
| Assigned Pfam label(s) | CL0063- PF01077- CL0608- CL0516- CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6JZU0 | 2-875 | KTVIVGGVAGGASAAARLRRLDEDTEIILLERGRYISFANCGLPYYIGGAIKEQDDLVLQSPESFHNRFRVDARIFSEVLAVDYNAK… |
| A0A7H4MX18 | 85-803 | MLVFSAGIRPQDALARSGGLNVGERGGICIDNQCRTSDPDVLAIGECALWENKIYGLVAPGYQMARAAAATLAGEAGCFSGADMSTK… |
| A0A261XZX7 | 182-959 | None |
| W4Q6R7 | 7-528 | None |
| D2A9G4 | 134-741 | None |
| W4Q9Z6 | 151-763 | None |
| A0A7Y3J0M4 | 256-857 | None |
| A0A7S0AI72 | 464-1170 | None |
| A0A3M5YIY5 | 483-1074 | None |
| A0A0B0HV23 | 2-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.