DPCstruct | MC19179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820MZS8 | 2-128 | DAILGNNMFTHYDRPHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNYFGRLSVDDCVECLKAMLQANIRQNLQVVV… |
| A0A819LPT4 | 152-249 | DRPHIAQLCEKAGLLQRALEHYTDLYDFKRVVVHTHLLNREWLVNYFGQLSVDDSFECLKAMLQANIQQNSQVVVQIATKYHEQLGT… |
| A0A446U4M4 | 433-553 | None |
| A0A804LHI5 | 76-196 | None |
| A0A813DAU1 | 512-623 | None |
| Q10161 | 602-707 | None |
| A0A6A4GT64 | 2-108 | None |
| A0A815YHH0 | 299-411 | None |
| A0A287R3U3 | 2-116 | None |
| A0A183EB65 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.