DPCstruct | MC19177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 165 ± 32 aa |
| Standard deviation of domain lengths | 32.35 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6TAI8 | 16-137 | DLAREIIAKYQKIITDLTDPTLRSMRLDDGGFNMELGGEVVKRMAIMMTTWFRESGAKNYVEIAINAIDPPFEKFLFYVQKRGDGAL… |
| A0A7U4T9Z8 | 1-172 | MKAEEKQDEMQRRIAACVNAFEGIPTERIAGKNLGEILAGEMRLHGAGPRADGGFGFEFSGGVCQLLAEAYADQFKQSGAINYLELL… |
| A0A7I0KNR2 | 12-234 | None |
| A0A3S1B5D8 | 68-245 | None |
| A0A1G0KTF1 | 12-141 | None |
| A0A1H8RFF8 | 1-156 | None |
| A0A085V6N7 | 61-210 | None |
| A0A6S5J0C2 | 1-206 | None |
| A0A0Q9P0R0 | 61-176 | None |
| A0A2E3M3Z4 | 12-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.