DPCstruct | MC19174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4YSB2 | 9-137 | KTSLIIALIRMARVDGRVNHYEQMNISMLTNTLGVNHAEVALLAKDIDNVPVVVPVTREDKVKYFWRILIMMKMDLQAHEKELKLAQ… |
| A0A1Q2MGH3 | 250-407 | SRLFLHNILAVARADSYLDGSEVKLIKSFCKKAGIGQNEYDKILRESINNPGNVILNGSPDEQWGTLLTLIKVAMADGQMSKDEIDI… |
| A0A3N5G1R6 | 2-140 | None |
| A0A848J1H9 | 2-145 | None |
| A0A848IYK1 | 4-132 | None |
| A0A6C0GD80 | 3-145 | None |
| A0A356KZT1 | 356-462 | None |
| A0A356KTF2 | 1-118 | None |
| A1ZFK0 | 3-117 | None |
| A0A1X7L8P3 | 15-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.