DPCstruct | MC19170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 63.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835TWG7 | 2-78 | MPITSSPPKWMAELENDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDEWKDAMVDIDAREMTRGKFLNILEKPK |
| A0A803VZM7 | 60-127 | SPITSSPPKWMAELENDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPK |
| A0A2I2Z977 | 12-93 | None |
| A7RGP4 | 1-69 | None |
| A0A7R9J760 | 77-154 | None |
| A0A6P4YMT4 | 60-134 | None |
| A0A1U7T940 | 80-151 | None |
| A0A553MQB1 | 18-95 | None |
| A0A667GBA7 | 85-162 | None |
| A0A811ZJ41 | 34-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.