DPCstruct | MC1917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2AVE3 | 143-248 | HHWAEHGIAGRGVLLDYRRHAEKKGIHYDSFDYHAISFDDLVAVGKDQGINILPASQGGDIQVGDLLFIRAGFVADYHAKSKEERKQ… |
| A0A5N6UBW6 | 15-102 | GKSCLLPTAEIQDRSNNHIGIHFWAQMGIAGRGILRDYASYSDRKGMNFNSFTLHEVKLAEIQEIVRECNITIQKGDLLFLRVGITCD |
| R1G5N4 | 6-88 | None |
| A0A4Q4YDH5 | 129-248 | None |
| A0A517LGL4 | 131-216 | None |
| A0A0F4YNR4 | 479-578 | None |
| A0A117NPE5 | 127-224 | None |
| G3JIA4 | 412-513 | None |
| A0A178AY06 | 2-109 | None |
| A0A5N6XR32 | 130-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.