DPCstruct | MC19169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 164 ± 20 aa |
| Standard deviation of domain lengths | 19.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 85.90 |
| Assigned Pfam label(s) | PF07324- PF10454- PF01086- CL0416- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E6ETC2 | 27-213 | SYASEIERKELLQKKHYFFLNELQQMARELPSKYQQRVPYDLLSGLAHALLDGTVFEIVQGLSEVQHLEEKSLFNQRVKQTNDHKAQ… |
| A0A803VKG9 | 13-198 | QQQQQQQVLSRQQERHYRLLAELQALVKALPSACQQRLSYTTLSELALALLDGTVFEIVQGLLEIQHLTEKNLYSQRRQLHSEHRGL… |
| A0A1Y1VCU3 | 125-268 | None |
| A0A4Y7NMZ0 | 292-454 | None |
| A0A6F9DBE4 | 14-189 | None |
| A0A0B7FTE3 | 1-143 | None |
| A0A819GLB5 | 359-546 | None |
| A0A166GPX2 | 2-155 | None |
| A0A077WQK2 | 28-220 | None |
| A0A4Y7NJI8 | 7-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.