DPCstruct | MC19163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1MMN6 | 3-59 | MRWLEARELFPNQFILVSILDYHEEGDKKIVDEVELIQSVSEKNANKEFFHAKEGTM |
| A0A7G5P2E3 | 1-80 | MKWQEVRELYPNQFVKFEIIEYHEEDKIKYVDEVAIIKAIKDPREAMQEFTRCKNGQLVYSTQNESVTIEKIRHVGIRRS |
| A0A098L209 | 15-91 | None |
| A0A3T1CZB2 | 16-99 | None |
| A0A2N0Z8H9 | 1-77 | None |
| A0A844LQQ8 | 7-68 | None |
| A0A1A6AT95 | 1-70 | None |
| A0A1R1D793 | 19-103 | None |
| A0A0N0D0P6 | 43-126 | None |
| A0A6N8HQW1 | 15-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.