DPCstruct | MC19160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 465 ± 60 aa |
| Standard deviation of domain lengths | 60.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3RUC8 | 5-433 | LRSLRRNEKTIRTRQIKPGENLKSLWDTIADDRSKFRLFDVSNKKVTMRKDTEIAESPYMFYNKVNEVEDAILFPDELTSDKKSVSF… |
| A0A2H3HF53 | 214-765 | LRNAWRMKHTREMYNHMVSLLRSLHRDDSTGYTRQIKPGEHVESIWDAVMDERSIVKMIDVAGPHIIVHDDDDVEESLYMFYNEANE… |
| A0A2I0RMY1 | 19-487 | None |
| Q0TVT3 | 57-452 | None |
| A0A4Q4TH34 | 487-947 | None |
| A0A395IY87 | 258-677 | None |
| H0EWV2 | 562-1103 | None |
| H6BML6 | 126-633 | None |
| C0NVX5 | 24-546 | None |
| A0A168FAR9 | 4-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.