DPCstruct | MC19159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 161 ± 15 aa |
| Standard deviation of domain lengths | 14.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8AEP9 | 1-160 | MHSPLLLPILLTTITLTTAQYLKDINPIAVDYPVHVDFVPDSTHLADLESPKLSEVNTTVFEWWYFDAVSSTNPNASIVLTFFTTTA… |
| A0A0J0D511 | 16-184 | RETMYLASILSSALIVASVAPSNPSEQSCVTGVELPFKLIDGHTHIETVSVKGGLDLPKLTPGVNASKLDWWYFDAVSATDNAAISV… |
| D4D8J3 | 1-178 | None |
| J3PHZ2 | 1-177 | None |
| M5GBL7 | 14-152 | None |
| Q5AR52 | 710-854 | None |
| A0A1V6YA82 | 528-716 | None |
| A0A5M9MXX8 | 1-155 | None |
| A0A1S8BAC7 | 1-168 | None |
| A0A1Y2W6L8 | 2-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.