DPCstruct | MC19158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 218 ± 43 aa |
| Standard deviation of domain lengths | 42.99 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420TZX6 | 246-412 | VDPHPKEDEEEDEEEEIKCKVCGNPNHTVSTCFSHTGKGQTFGCPLCDAADHTGSDCAEIAKLSLTEQVKLLITNRGNMPAFHEGPK… |
| A0A0J0CD86 | 19-219 | MSAIIPDKFEAIERDHTQKVVMNNDFGDKGGKPVGLFGRNIQAPSEKKHVVKGWCKLCGSKSHTLTDCVMRGYKGHVTGCPICNDQK… |
| A0A366S8F3 | 188-427 | None |
| A0A5C6T8Q9 | 1040-1238 | None |
| A0A2K0W6P6 | 7-172 | None |
| A0A365MYE9 | 26-231 | None |
| A0A365MKA4 | 141-314 | None |
| A0A1B7YQG1 | 1-216 | None |
| R8BUP9 | 144-356 | None |
| I1RRA8 | 17-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.