DPCstruct | MC19156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5AW24 | 2-91 | SAIFGEKLTFSQEKGPDVKLVVNGDEFYAQYETEDGYSAIYDRDLGLFCYALLKDGAYYSSKIPISNSPPLDLEKHLQEAGSIRLAK… |
| A0A7Y5FF48 | 16-116 | AINNNLQAAPFDTGMITIKQPNGVDFIGRMWGDEFIWWAETEDGYRFIESGDGWYYYAALDQSGEYTPSNYKVGIDTPPASSYQLER… |
| A0A800C5C4 | 7-112 | None |
| A0A354ZC23 | 1-83 | None |
| A0A1G6GUS6 | 39-129 | None |
| A0A2K8U9E1 | 21-123 | None |
| A0A382D253 | 21-121 | None |
| A0A6G7X640 | 16-120 | None |
| A0A559QN76 | 12-105 | None |
| A0A4Q3BPA4 | 33-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.