DPCstruct | MC19155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 12.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6MUX1 | 1-67 | MSLGDWIISVLVSKIPLIGFIMLIVWAVDSNTDKNKSNWAKAELIVTLIFIGISILFVAIIGFGFFA |
| A0A7Y5CIW4 | 1-84 | MDQNNLPGSFRQEVSVGDWMITLLITALPLIGLIMLFVWAFGDGTNPSKKNWAKATLIWYAIWFVLVIIFFIMFWAFISAMLSG |
| A0A7V6N8Y4 | 4-92 | None |
| A0A3A5TL36 | 62-147 | None |
| A0A3P3VUX3 | 1-105 | None |
| A0A3M1TK59 | 3-71 | None |
| R9J9Q8 | 59-149 | None |
| A0A417B3F1 | 81-169 | None |
| A0A1I0MTA4 | 99-172 | None |
| A0A3S5BW25 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.