DPCstruct | MC19150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.84 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF05979- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380MN25 | 4-70 | ELKRLNVLARLPTLSPEQRAEREQLRQAYLAQIRAQVSGHLSVMTVIDPNGKNVTPAALRDAQASGN |
| A0A366XVK9 | 2-75 | LSSKKLQRINELAHKSKSEGLNPEERIEQQKLREEYLQTFRKGFKKHLHGIKVVDPEGNDVTPKKLKVSKRNQN |
| A0A844BJ12 | 1-76 | None |
| J9LIH9 | 10-86 | None |
| V6J2P0 | 209-281 | None |
| A0A559U041 | 19-97 | None |
| A0A1T4P3U1 | 1-76 | None |
| A0A2K8NX69 | 10-75 | None |
| A0A2A5RK03 | 8-81 | None |
| A0A0M4JSB1 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.