DPCstruct | MC1915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 12.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0NB76 | 2-110 | AQPLLVTFASADGSQFRAVIERPEDIARVQTALEGDGYAGIPNGALAAGDGGFNAPHAWHMTAVEIVDVTIELCDGNASFVDEDLDY… |
| A0A2H0JSR6 | 16-136 | VVACDSDSNSDAPIDGAVFVVEVESGEQFRILLRNEAQIAEAEALIGASTQKIVNGQLLPGDGGFNDPWSWHMDPESVSFADVTIEL… |
| F4QFB9 | 29-154 | None |
| A0A7I0JTU3 | 4-116 | None |
| A0A7V9UDG8 | 135-239 | None |
| A0A7S4QT50 | 64-182 | None |
| F4Q4Q7 | 16-129 | None |
| F4Q0Q5 | 1-101 | None |
| F4PTD2 | 8-102 | None |
| I3RKR7 | 331-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.