DPCstruct | MC19143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 230 ± 32 aa |
| Standard deviation of domain lengths | 32.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0QB25 | 9-139 | EVTPTRLRDVFALALDNAVEGCVHEAFAAVLCRFQAVTCRDLALAADLDVIAEDEARHGELAWAIARWLEPQLTAAQRAVVERARAV… |
| A0A2W5VT13 | 100-302 | DMPGRPPTNGRLPDEAEPWARMAWFEAQSAHEFEHLATQLEALGAPSHFVSRARAAAVEERGHARIAERRAGRVVTVDDTPFRSRTV… |
| A0A1I2H5A8 | 242-492 | None |
| A0A7S3PNL1 | 42-277 | None |
| A0A2S9YIQ5 | 3-225 | None |
| A0A3S5GY27 | 3-187 | None |
| A0A3A8GJQ9 | 81-316 | None |
| A0A849ZM85 | 43-300 | None |
| A0A3A8P5C1 | 47-262 | None |
| A0A1M3NEJ9 | 50-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.