DPCstruct | MC1914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 118 ± 21 aa |
| Standard deviation of domain lengths | 21.15 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9CZL6 | 5-100 | SLSYEERPPTAGLIKGSVLFTDGSRLDLKEFLIIHPTLRVIKYAYHYRREDQLIFRYDNANDPAARNLPTFPSHKHIASGILVAEKP… |
| A0A0P0N3E4 | 8-107 | VARLERLELTVRGDIVVEKATAALVDGSKLHLRQIRRGDKVIAYSYYWLSQSGETIEGWDNAPHHPEVETYPHHRHVGGEVRPLEDP… |
| A0A7Y4UI61 | 8-121 | None |
| A0A1W9ST75 | 10-120 | None |
| A0A4D7Q8W0 | 39-174 | None |
| A0A3C1SF65 | 8-125 | None |
| A0A522UME4 | 22-95 | None |
| A0A3L7WS58 | 2-113 | None |
| A0A1F3XWG7 | 1-126 | None |
| A0A0S6VWH3 | 23-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.