DPCstruct | MC19137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 143 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04354 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0WY87 | 1-143 | MSNTLFIFINSTEVPSLRSLQTSINKLDFKLQLDPTYTAFDDHGYSPCVLNNSISAGFEITYEPAENITRGHPELREIAGPNDYCIQ… |
| A0A2W5TFL7 | 2-126 | QRSYDFVLQGRTPGEPAPLDQLLVALSARGAQLDAKGFGLLKVDRGEATVQPTLENGVTIALDVRVPFHEKLELLESVFKVLVEAAE… |
| F6GGU9 | 23-197 | None |
| A0A5J6V259 | 1-139 | None |
| A0A7X1TKR2 | 1-121 | None |
| A0A2N6EYE4 | 1-105 | None |
| A0A2T8F7S3 | 1-161 | None |
| A0A3R8LET4 | 143-290 | None |
| A0A3T0KAK1 | 45-215 | None |
| A0A7X1AV71 | 1-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.