DPCstruct | MC19135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 231 ± 18 aa |
| Standard deviation of domain lengths | 18.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5SVX4 | 12-257 | TEPDFKNIHIMPAWGSEREPGFYYLVADAAQAAPLNFQEAKNQFGRDHAFEGACGTLLKHVEGMTHGVNDIAQYDVILIDEAQDLPQ… |
| A0A659L865 | 1-225 | MDPDFEGTIDILHAWGGGNAPGVYYNTCQNNSARFINFGEAQRVAPKEPFSYACRNLIENYAIKKQYDYVFVDEAQDFDSSFLQLCL… |
| A0A1L9QTK0 | 318-560 | None |
| A0A415FNC9 | 77-297 | None |
| A0A1I0AXN6 | 514-773 | None |
| A0A376RNS8 | 1-193 | None |
| A0A1Z4RX97 | 327-535 | None |
| A0A3D4S138 | 268-508 | None |
| A0A380WVS4 | 243-475 | None |
| A0A1C3TT29 | 1-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.