DPCstruct | MC19130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0QPM8 | 236-337 | LLLSIEGLRGLDWKRLLKLQLSDGSFLSSPAATAYVLMQTGDKKCLEFLDGIVSKFHGGVPFLYPIEIFERVWAVDRLERLGISYYF… |
| A0A5P1FTE7 | 4-102 | SVHTTLLYSVEALQEIVQWKRILKLQSPDGSSLSSPAITAVAYMKTGDSKSLEYLTNIVQRFRDHAPSQYPIDLVERIWAIDTIEIL… |
| A0A287Y182 | 4-104 | None |
| A0A5N6PT62 | 439-533 | None |
| A0A484M8D2 | 211-337 | None |
| A0A6J5X8D8 | 4-118 | None |
| A0A7J6EZG1 | 183-309 | None |
| A0A7J7GUV3 | 67-179 | None |
| A0A446LDR8 | 137-234 | None |
| A0A446K8P1 | 131-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.