DPCstruct | MC1913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 210 ± 26 aa |
| Standard deviation of domain lengths | 25.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N0DZT5 | 241-473 | GYPGDDYNRLDRLEPINYDRMPPPVMPIAPAPAPPPVVPPATAPGPTPWSSQNQPGAVQPGTANGTPPPGGTPPIRTPGADGSVDYM… |
| A0A853LQC4 | 1-213 | MPAFGGGSLPGLGGLPASGAGWEPAGGLPFDAALGDDRPAVEDVDDDTPADADQADLPEDRDEDPAAPSDDDAAMPDETLPVGPTPV… |
| A0A1V2TFQ9 | 52-231 | None |
| A0A1S1NG31 | 172-388 | None |
| A0A1A2C894 | 3-215 | None |
| A0A7H8L170 | 3-163 | None |
| A0A846XJH5 | 479-702 | None |
| A0A2S6ACP2 | 18-252 | None |
| A0A5A4W5V8 | 158-328 | None |
| A0A850DET7 | 247-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.