DPCstruct | MC19127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 774 ± 83 aa |
| Standard deviation of domain lengths | 83.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.12 |
| Pfam Score | 96.30 |
| Assigned Pfam label(s) | CL0020- CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H9AWW2 | 162-955 | SAIASKAQSYTDLSSCVKTSNNYPSLPKQSKHGRKAIAVMTSGGDAPGMNSNVRAIVRSAIFKGCRAFVVMEGYSGLVHGGPEYIKE… |
| A0A536U931 | 2-587 | SMRNAFYAQSGGVTAVINASAAAVIETARKHKSRIGKVYAGRNGIIGALTEDLIDTSRESSAAIAGLMHTPAGAFGSCRYQLASIDK… |
| A0A7C8PBR6 | 206-829 | None |
| A0A812IER5 | 226-1098 | None |
| A0A6F9CEK9 | 9-827 | None |
| A0A4T0JJG8 | 6-859 | None |
| A0A421JFV5 | 161-959 | None |
| A0A137QPD0 | 2-798 | None |
| A0A834IVF1 | 13-840 | None |
| A0A059EZS9 | 62-823 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.