DPCstruct | MC19125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8ZFS2 | 5-103 | SPTSPPPPSPPPPSPIAPTSPPSPSNGHRHGHHHRHRHGGDYQETPAEEECCRWLKEVDTKCVCDLLVYLPTFLAKPRHNYTVTVAQ… |
| A0A1S2XS23 | 21-159 | PKIEGQVGHIIPTNPRPLCPSQFALVNYACGRLPFTPGPLPEPPSPDDDGGDDDGGDDKGHNNHHHHHRHEPGHRHKHGHRHRRHQT… |
| A0A328DQK6 | 12-137 | None |
| A0A0P0X9X1 | 50-155 | None |
| A0A7C9AQK2 | 39-185 | None |
| A0A5A7P1A7 | 139-255 | None |
| A0A5N5KC42 | 34-148 | None |
| A0A830CNQ8 | 1-111 | None |
| A0A7J8URE5 | 107-233 | None |
| A0A6P4AZX7 | 18-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.