DPCstruct | MC19124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 223 ± 47 aa |
| Standard deviation of domain lengths | 46.59 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830VBF7 | 74-349 | FLAVLKLRAAPAAKNVLDAIEVLRGMNTDNARKLPADAPTGFIKPRWQKLVMTDAGIDRRYYELCALSELKNSLRSGDIWVQGSRQF… |
| A0A7X9NPE8 | 27-281 | RFPKPITFRQFESVENHIPKKWAYYIHSNPNEVNQSMLILGVELLIQSLNKHDIFVPKSERFIDPMSCLISEDTWEQQKESLLSQLE… |
| A0A5S4FVU5 | 17-265 | None |
| A0A1V5BYA1 | 204-441 | None |
| A0A1X3K4H6 | 13-175 | None |
| A0A3G1QC57 | 70-321 | None |
| A0A100IZK9 | 7-214 | None |
| A0A0E3B8H8 | 397-600 | None |
| A0A5E6XPN1 | 9-174 | None |
| A0A7W1LY68 | 162-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.