DPCstruct | MC19120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 17.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A200I0E7 | 51-200 | AKEDILTFLDQQIDQKVTDYDVALDWNTKNHTIEIIFRLYLASNEELAGEEEVEAIEFEDGILLYTEKSQFDANDYLYTMPFERKKG… |
| A0A0Z8G8T9 | 113-266 | MAKHGFLDVLEAALDKHFTYDYELNWDKKNHAVELAFILEAQNAAGIETVDDEGNASAEDIFLEEYVLFYNQDKSRFDEEDYLVALP… |
| A0A2N6SNJ0 | 41-202 | None |
| A0A5C5E6U5 | 87-246 | None |
| A0A6G7WEE6 | 3-164 | None |
| A0A1T4PW96 | 1-194 | None |
| A0A077ZMD6 | 118-262 | None |
| A0A1L8RGQ3 | 3-138 | None |
| A0A6M0L8I3 | 1-127 | None |
| A0A655MUJ1 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.