DPCstruct | MC1912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 545 ± 61 aa |
| Standard deviation of domain lengths | 61.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P3ZK57 | 4-572 | YWERPDDKQAILHRFQRSFDSLPASMRVLPACKAELHLSLDALNEVLHRCIALRDVEARGLLDTLTSTTSFMRSWQTLVCQGFTRLL… |
| A0A653DPR4 | 87-636 | EYLIAQLPPDLSYALASMWENLEDVYIDDFQQLLFIKRLLLNAVMPFSNYAKQYMTDVITAPDNRKDYLRRFQQIYNEFDDDVRVDL… |
| A0A397EK52 | 571-1056 | None |
| A0A485KLQ4 | 406-959 | None |
| A0A813DC41 | 60-656 | None |
| A0A498P2H4 | 252-880 | None |
| A0A067C2W6 | 279-737 | None |
| A0A067BNL8 | 5-411 | None |
| A0A7S4PBY1 | 5-552 | None |
| A0A7S1KTK4 | 550-1069 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.