DPCstruct | MC19114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1RYS3 | 9-91 | QNVGLIWEIIKLYEGEVFKTKIGVPFTYKAYTDYIIINETNQTIKKEYFKLACRFMPDLELKNIQKITRGPQYIYAILTSNKI |
| A0A3D1TQ42 | 3-88 | NFTTIWERIAALAGSEFRQKTGRQFTFSIVGNAVAPITTNRLLARCQFQQAYQRLPLRGPGQLQDLQGPSYLFAILTDPGVTTGSS |
| A0A497SAF8 | 4-93 | None |
| R9MCH3 | 253-353 | None |
| A0A1Y4H173 | 14-111 | None |
| A0A416SDA3 | 2-112 | None |
| A0A3E2U396 | 10-120 | None |
| A0A173UCL9 | 36-135 | None |
| A0A2V1JS43 | 7-100 | None |
| A0A413LME5 | 8-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.