DPCstruct | MC19112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 207 ± 19 aa |
| Standard deviation of domain lengths | 19.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.62 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0182- CL0471- PF21113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5TXE3 | 15-229 | YAADLFLKTYPVVYVHTVIGTDSGGRLAVKGLFISDDEQGFRQAAELSLKVNFEILDKPLKKVVVWMDPAEFRSAWLCNKSIYRTRM… |
| A0A3D0ULI9 | 44-263 | HPEATWGITAGNPIWEEMREVALRTQPTFLLNVTLNVDRQITGVFAGDMSAAHAQGCAFVKKQAMVGVNAPYDIVLTTNSGYPLDQN… |
| A0A353V2Z2 | 3-229 | None |
| A0A2A5NZX8 | 118-319 | None |
| C1EGZ4 | 457-666 | None |
| A0A7X7KN72 | 102-291 | None |
| A0A7E4SF04 | 888-1106 | None |
| A0A7J3WG83 | 156-334 | None |
| A0A3D6D8I2 | 10-218 | None |
| A0A7C3F1A0 | 46-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.