DPCstruct | MC19111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 513 ± 58 aa |
| Standard deviation of domain lengths | 57.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7P167 | 1-520 | MTPFAVVPTTTFGRSGRHRDMLIIDEHTGTQWDAPAHFVPPPDSGLPGAGPTGLMTNEKVPAWQFCGEACVIDVTARRDQAEPGSSF… |
| A0A3D0D7P3 | 5-542 | DSRAQPILSITPTPFVPGGFHVLRRVVDLSLGTVPLTTGPLPNDALATHIEPTGPGHPRQFVQRVGLTLPYVFPNREIGVDVYLGDS… |
| A0A060SJI5 | 3-494 | None |
| A0A7R8X4K2 | 564-1109 | None |
| A0A7J3BHY0 | 1-598 | None |
| A0A1V9Z3J2 | 2-579 | None |
| A0A5J9SST6 | 229-743 | None |
| A0A7R8ZMH3 | 5-518 | None |
| A0A7R8ZLS7 | 374-894 | None |
| A0A1S3HJC6 | 31-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.