DPCstruct | MC1911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 593 ± 179 aa |
| Standard deviation of domain lengths | 178.88 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P3Z2L3 | 36-600 | WPEALVADEAFARLAAEHADLACDPKRNAAALRGVEDAMNECGDAVAAALRHAALMRDLASRYPFLRLHEEEGWPEALVADEAFARL… |
| A0A3L6KUI1 | 1-317 | MPEGVPLSELGLDKDEKFSTMEEERRKLIAEDREGNAARIAELEAAMNEHSHELAKLKASDSRSFLDPMPEGVPLSELGLDKDEKFS… |
| A0A7G2CUI9 | 83-901 | None |
| A0A7G2C8G1 | 107-751 | None |
| A0A7G2C0B6 | 412-944 | None |
| S9TRF0 | 3-808 | None |
| E9AGL7 | 446-1411 | None |
| A0A6L0XLP7 | 2-492 | None |
| A0A6L0XH57 | 49-521 | None |
| A0A836HK70 | 4-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.