DPCstruct | MC19109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4X0N7 | 1-77 | MIVLTNKDTGIELGKITEAQLQFLVDQLEEESPTDTDYWLNRAELEILKENGADPELLALLEQGMGEAEDMEVSWAR |
| A0A3D0D6J8 | 28-105 | VRLYDEATGVELGTIREEDLAFLQANLEEEGLDDHDYWINPTTIEMLETRGASPQLIALLRAAVGTNEAGVDVEFERE |
| A0A6J4IRC5 | 150-225 | None |
| A0A2H3LD40 | 406-479 | None |
| A0A517ZIG3 | 124-199 | None |
| A0A7X1PEY6 | 6-72 | None |
| A0A350AU27 | 1-87 | None |
| A0A7C3P283 | 6-72 | None |
| A0A6A0CDC0 | 2-86 | None |
| A0A2W4LHT3 | 203-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.