DPCstruct | MC19106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 269 ± 30 aa |
| Standard deviation of domain lengths | 29.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 14.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8UEX1 | 4-241 | ICSFWDAGCVDPLAQTAIAFGFPPLFLENMNLFYAFDADPRGKGQEPMTKVSFWIGYEAYINNSVIDLNRTSEIGMRVGNLTGSPSG… |
| A0A136ISU6 | 26-299 | SSTAASLSPVQLVARNNTDLGDFLSNPNPDVSGRVNMPGFRLDTTYPGAGGTKPWSLELNITRWAESSMFPGNNATRISAQIIPPSP… |
| A0A4Z0ZA95 | 24-318 | None |
| Q2GRS6 | 22-271 | None |
| A0A507BHH2 | 43-310 | None |
| N4VKZ4 | 119-436 | None |
| A0A364N7T8 | 1-281 | None |
| A0A1B7YQY4 | 4-249 | None |
| A0A2T2P0C7 | 17-363 | None |
| A0A0F4YJ80 | 114-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.