DPCstruct | MC19105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 229 ± 26 aa |
| Standard deviation of domain lengths | 26.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D8R4W0 | 121-349 | GSTPPPSPTKPVLRKCHNPEALASELSKYLVDYGKYPNAPNVHPRPVTYPNQKAKDDWSELPDADDRDTFEEWGRNMWAPGRVSSLA… |
| A0A136IKA0 | 60-263 | RLQTRELLSEHFTGVSIPKDIPYVHPRCISFRNLKERNDAIRPPGTRDTRWPIDLAVRDTFKEFWQAPKGCTRTWLAFFAYPPSDSH… |
| A0A2V5HV18 | 249-438 | None |
| A0A1L9TB15 | 1-249 | None |
| A0A166NKC3 | 423-644 | None |
| A0A0C3GLU7 | 502-698 | None |
| A0A4T0VJF2 | 220-455 | None |
| J3PIY4 | 4-250 | None |
| A0A0C9M398 | 49-311 | None |
| A0A6A4HI04 | 153-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.