DPCstruct | MC19103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 13.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2PSF0 | 3-99 | NPRTLQARELHLISLYSHWEFGMTPREFYAKWAVSYEQIALICSRSDSTVKGWFKQGRNRRYPTGNDLRHLAVMDFLLEHFEEIPEH… |
| K9X7H4 | 141-234 | IAAKTPTRRHWDLFEIYKAKVAIKMEPEEFLKHWVVNYEELAELCGRSKSTVAHWFSQGEHRREPSEADKRRLAEIHALWTQFENEP… |
| A0A0S3UF43 | 1-96 | None |
| A0A6M0B7K3 | 16-103 | None |
| A0A2T1CXC4 | 1-104 | None |
| B4VY47 | 89-180 | None |
| B4VP31 | 144-246 | None |
| F4XU66 | 227-325 | None |
| A0A6M0GE15 | 14-97 | None |
| A0A846GPT0 | 21-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.