DPCstruct | MC19102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 4.91 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2PPQ1 | 1-79 | MRRPRFVNEVIERIDRPGVATGLAWTPTGGDVLFVEATMMPSQEERLILTGMLGDVMRESVQAALSYIWSNADRLLILL |
| A0A7R9K9G9 | 43-131 | LPVIIDIVALEDILGPPFYLDNELWSRVGRPGVAVGLAWSTTGAQVMIVEVSKMEGTGELILTGYLGRVMKESAKIALNWVRTAAIE… |
| A0A381KMM7 | 286-373 | None |
| A0A3S5DC06 | 68-153 | None |
| A0A0J9TKU4 | 423-506 | None |
| H2XWD5 | 7-80 | None |
| A0A7J7APY4 | 85-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.