DPCstruct | MC1910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 151 ± 18 aa |
| Standard deviation of domain lengths | 17.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1EPZ9 | 70-196 | PFPIAEQRELGLQAMRILGFDFDGGRLDISAHPFCGGVPQDVRITTRYNENDLLSALFGVIHETGHARYEQNLPRPWVDQPVGLARS… |
| A0A3P3Z1F7 | 1-170 | MDTRPVELPIPIAEENLVMFGRQLMRALWKYVWDVGRYDELPHPFGGMVMEASQMKYCWLPDSRIGCLLATIHEIGHTQYRQNCGSR… |
| A0A090PJF8 | 195-353 | None |
| A0A812S5M7 | 633-790 | None |
| F4MZA5 | 1-160 | None |
| Q4UKJ0 | 202-336 | None |
| A0A7Y4TBJ8 | 698-853 | None |
| A0A0B0HKG7 | 56-169 | None |
| A0A2X4Z5E6 | 136-293 | None |
| A0A2V0NUH9 | 265-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.