DPCstruct | MC191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497C579 | 257-374 | SLSEETGSPVFATEGSYLGFYIGKNTLQSYARPYEYEPVRHVPISMTSFDYYETGMVSNFEGRETWVYTTPHNIQRFTPQMESCANC… |
| A0A3N5WSW3 | 1-87 | MTLRHAPIAEDNFDYYGKDLLSNFNSLPTWKYATPHNIQRKTHQNAACSNCHGNDDLFLTADKVKPEELEANQPVIVPAAPPAVSGQ |
| A0A661PU22 | 52-158 | None |
| A0A6H9KDA1 | 202-317 | None |
| A0A497B7V8 | 1-86 | None |
| A0A7C7RR05 | 78-190 | None |
| A0A1F9BAY6 | 130-222 | None |
| A0A7W0EHP8 | 333-440 | None |
| A0A1G0CXT4 | 1-119 | None |
| A0A1W9WI85 | 321-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.