DPCstruct | MC19099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 180 ± 28 aa |
| Standard deviation of domain lengths | 28.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5L0T9 | 164-337 | LTPTMRDSEKRGAAYAALVASADSRVVTIIDLVGPDAVAFAAGAAALLDPVFLFDNWPHPRGVVPAHLTLAAATYYQPKLAKAKEER… |
| A0A7W1IT06 | 1-197 | MPLPWLPPPGDTALVFDLPGLEGIVAGLAVAARGYRPVPVYTSCTGQHEIVQTRPLLWGLLQAADTLERLRLPIAAPPAFLLDARRL… |
| A0A1F5GV47 | 102-269 | None |
| A0A3R8QBN2 | 43-275 | None |
| A0A7Y4UC86 | 188-362 | None |
| A0A3A4ZCM9 | 195-352 | None |
| A0A7Y4ZUD7 | 102-317 | None |
| A0A1G1C9L5 | 104-312 | None |
| A0A1F6CKJ2 | 4-141 | None |
| A0A1Y4S5Y8 | 55-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.