DPCstruct | MC19096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 199 ± 20 aa |
| Standard deviation of domain lengths | 20.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517T3Z5 | 3-194 | TCASNPGNVRINFARFLWADLKDTIILVVVSVVCAFIYPQEPRVAYIIGGIGLFVVLYGLYQANSLFREGDACPGIVLDPASGSIAV… |
| A0A7W1G2Y6 | 182-377 | DSSASRPGLIPVNEELLRELQPELYRGKQLTGRPAKILGTSLPPSEWIARLRTHAACGDLQPALVVRLDPLVIAVRTDELDCVALVG… |
| A0A518AGU7 | 78-282 | None |
| A0A0Q7X6H4 | 275-450 | None |
| B8FIW8 | 163-351 | None |
| A0A146HN81 | 190-379 | None |
| A0A1A0K1K7 | 5-216 | None |
| A0A517XQ52 | 10-197 | None |
| A0A3N5ZBX2 | 205-437 | None |
| A0A6N7BY55 | 8-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.