DPCstruct | MC19095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Standard deviation of domain lengths | 12.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3XEE6 | 4-137 | LPFHNICPSTAEKETRVITLQQNDNEFHLPQGDYVFIELFCDECDCRRVFLQVFMNQKIVATIAYGWEKLSFYKKAFKGFNEKDIKE… |
| A0A7W1FIE4 | 2-131 | SFIAAGEVLGATTPTRTVRLHGHPHLPDGAYTLVDSYCIDPGCDCRKTMVLVYYERRHVSTIAYGWETTAFYQAWYGRPLDSQTRAE… |
| A0A0J6YVT6 | 65-211 | None |
| A0A2M8BW10 | 5-139 | None |
| A0A2E5HML7 | 1-122 | None |
| A0A5C6AMS0 | 2-143 | None |
| A0A833JFC2 | 176-292 | None |
| A0A1V1P4B9 | 28-186 | None |
| A0A0F2N3R2 | 144-289 | None |
| A0A2V9WUV5 | 44-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.