DPCstruct | MC19094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 145 ± 9 aa |
| Standard deviation of domain lengths | 8.95 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4M0G9 | 186-331 | GQNKQEMKPGDVRIIMARTADGRLVATRYRYATADREKPNAFSVETASSGKDTVDDVVPWNDLPMNAKVEKDGYVLEAAIPWSELSV… |
| A0A7W1F4K6 | 1-134 | PARGDTCVCIAQFAGKPVAVLMRPVDPGAPAGAAHTYVSPVMPHRFDRVEAFTAAKVAVKVEPSGYLVEVALPLAALGLKPTGLLRG… |
| A0A7Y3K6V5 | 1011-1170 | None |
| A0A7X7ITZ9 | 234-380 | None |
| A0A7X6ZQL8 | 342-474 | None |
| A0A1V5HF31 | 1131-1266 | None |
| A0A1V5H6H2 | 3-143 | None |
| A0A7W1F189 | 471-618 | None |
| A0A7X1B3D7 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.