DPCstruct | MC19091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 138 ± 17 aa |
| Standard deviation of domain lengths | 16.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A081PCN4 | 6-137 | MGYAFGVIATSLVLLWIGILKFTAAEAAAIKPLVEHSFLMSWMYKIASVNIVSVLIGLFEIITGLLLLLSFRIKIAGKIGGYLALII… |
| A0A7V6H323 | 7-143 | KIFSVIALVLLRYGLGIALIWLGIMKFKNIEAEYLQDLLANTTIFKWILKYFTAYAFSQMIAWIQIVAGVLLLIHPFAPKVSRWGAV… |
| A0A1F3BAR5 | 7-127 | None |
| A0A838KSE0 | 28-170 | None |
| A0A7V9GEX1 | 18-160 | None |
| A0A495VY06 | 21-155 | None |
| A0A455ZEN2 | 136-302 | None |
| A0A5E4S1L0 | 13-142 | None |
| A0A1F4X9K1 | 13-150 | None |
| A0A5M8SY51 | 17-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.