DPCstruct | MC19090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3CQL0 | 1-90 | MPGLRQQHWLEGNRTVLIYGGSLASEPDREKYIALRKLRRGRPLDGIVRVMPSSLTLTPLISESDLHGLEKISELLGYAAPVWLWKL… |
| A0A3P8JT99 | 54-138 | PGLKRDLWQESNGIVLIHAGMANSTPDPEFVESLNQVRAQRPVDGIVQVMDCAMLPDAAALDTLVRCRQKGDSLLGWQAPVWLWF |
| I2T188 | 2-82 | None |
| A0A4U9HWD2 | 137-231 | None |
| A0A376KZX4 | 2-81 | None |
| A0A377V943 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.