DPCstruct | MC1909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 200 ± 16 aa |
| Standard deviation of domain lengths | 15.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7X6L8 | 1-194 | MKQIAALFLLAMSLYYIYLGWRVLSTKRPFIVSSGLLMSFALLIYLVLIILEAVRFSQTGSLEGQEIIMLAVTIYFGVKCWQLRRTY… |
| A0A1V4R0D3 | 6-170 | HSALLVLPVAVYFLLLGLLNSRPRPQLLAARTDFLLLNGAFLPAFCVPVVGAMAGSTWALPLVLGALVGLMALLAPPRRGSWVIYNI… |
| A0A7V4M5G7 | 48-262 | None |
| A0A7X8L3F2 | 1-185 | None |
| A0A352DUT8 | 19-223 | None |
| A6TQ68 | 5-218 | None |
| A0A3D5BA69 | 5-204 | None |
| A0A3E0N2M8 | 1-223 | None |
| A0A1E5LA27 | 4-202 | None |
| A0A2V3A4B6 | 37-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.