DPCstruct | MC19083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 12.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8FDR6 | 1-109 | MTLPRKGSRTITVDEIRYRWMVSVRDHTLNLTIEAAGSPGQVLQARFEPHDQFRRNRDGKWSFCRQGRSLTPTDVTKIVKYGLANDW… |
| A0A318IU59 | 1-114 | MAKSKLRRLKIGDNNFLWTVKALYLPRTDVTADYPVQVKFTAFLESYKTTALHIHFKTSSTVAGNWLTSGIGEVNLHLPSFARLLIV… |
| A0A1N7R4X1 | 27-133 | None |
| A0A7W7MBI1 | 2-106 | None |
| A0A1E7KDW7 | 1-108 | None |
| A0A7X6CJF4 | 36-131 | None |
| A0A2U3HE82 | 2-95 | None |
| A0A1W1UJS0 | 2-96 | None |
| A0A6B2WI71 | 5-126 | None |
| A0A371QAC3 | 5-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.