DPCstruct | MC19082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A147K3F9 | 2-100 | EELKEHGGEICSKFGISRGDFDAILSSLSIFVTTVPKSVFKSFLLEAEKLLPENPDDVPYIALGLKLGCPIWSEDEDLKRQSKVKVF… |
| A0A510PEK8 | 10-116 | DFFTTDRCYADARRYLPILFEKRDLGSEDAMAVLEGLTGWVRIVDNSLYASYEGEARKRIAARDVDDWPVVALALLLECPIWTEDAD… |
| A0A842KSL5 | 2-72 | None |
| A0A5E4IJP3 | 41-140 | None |
| A0A843CGP8 | 18-111 | None |
| A0A842XY74 | 5-78 | None |
| A0A842SG35 | 1-86 | None |
| A0A256ZIB0 | 12-119 | None |
| A0A2R6DJ15 | 2-91 | None |
| A0A3M1RFX1 | 15-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.