DPCstruct | MC1908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 157 ± 23 aa |
| Standard deviation of domain lengths | 22.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A037Z3V4 | 82-256 | FTRFLRVASIFTIITLPSLYLSFIKFNVELIPLKFIVPIINSRIGIALSPFFEIFLMEIAIEVLREGGLRLPTKVAQTLSVVGGIIL… |
| A0A0Q9W6M4 | 173-336 | FLRVLGALVTLIFPALYVALVAVNPEILKIELALSIAQSREGIPYPPFVEITIMLLIIELIIEASIRLPLSIGPTVTMVGGIVIGQA… |
| A0A4V3HDA9 | 9-178 | None |
| A0A1Y0CRY9 | 1-142 | None |
| A0A3B0BDB7 | 90-229 | None |
| A0A2C1C624 | 263-439 | None |
| W7ZH67 | 19-194 | None |
| A0A7Y0L2F0 | 132-301 | None |
| A0A6N9PY75 | 310-485 | None |
| A0A2S8PMM5 | 239-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.