DPCstruct | MC19077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 20.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y6D2V6 | 12-123 | ALATKLEQRVHAASETGGDFRLSEVADFDWDTFHVFTPYVGAEEVRKWLGIDWSGARDVYESECLLVFVKGGEVVMDLDFARTKGDF… |
| A0A7T9FZR9 | 20-146 | SNENERFFNETLERKVLYSKTDSVAINIKELVRFDWDYFIVIPPYTTIDRLEDSIDVKLEKVKDTRIETNDSFVVLAFIKEHTLIDC… |
| A0A6H3LN57 | 37-173 | None |
| A0A3M8CZ37 | 43-180 | None |
| A0A5J5DTI8 | 11-148 | None |
| F8F5P4 | 107-236 | None |
| A0A4R2K4J2 | 17-141 | None |
| A0A7X8KEX4 | 15-150 | None |
| A0A1L7CES3 | 6-147 | None |
| A0A373W8A6 | 307-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.