DPCstruct | MC19076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9MUU1 | 298-392 | IEEALGGVLFIDEAYSLARGGEQDFGPEAIDTLVKGMEDKRDQLIVILAGYTDEMRDLLKKNPGLKSRINIEIDFEDYSNEELLQIA… |
| A0A416E6M4 | 1-74 | MREVAKGGVLFIDEAYSLQGEITITTLLREMENHREDVIVIFAGYPEPMQGFLDRNLGMRSRIVFQVKFEDYYS |
| A0A7X9NG83 | 50-126 | None |
| A0A7S2DB91 | 30-129 | None |
| A0A532V139 | 341-407 | None |
| A0A2I1P852 | 144-222 | None |
| A0A1C4M7L5 | 258-324 | None |
| A0A2U3DAU2 | 194-271 | None |
| A0A251WKR5 | 304-370 | None |
| A0A0M9DJL6 | 391-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.